PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009121515.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 426aa    MW: 47269.5 Da    PI: 4.4828
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009121515.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK76.33.6e-24331381252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     + +++l+d+s++F+lpi++AA+ + +c+Tv+K+iCR+ G+ RWPhRkiksl
  XP_009121515.1 331 TGKLKLKDISMHFHLPIQEAARRMSLCPTVVKKICRRGGLYRWPHRKIKSL 381
                     56899********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.53312401IPR003035RWP-RK domain
PfamPF020421.0E-20334381IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MAGDDDPKPP GLEDKDDGDP YYEPFSEEEL QNLMSNQNPN LMDFAFTENP LPPPTTTPIT  60
IATSDIIETE MLNQLSLTIP NCDDTDDFLV TSFDDDIDLS WDLSDIPSEF LNDNMDSNIL  120
GEIGTNDDNG NIVGGTGTLE VSTRVFVENG PNVEAGGGSS APITPTVSNG ILVCTCCNLL  180
RTLIHSNGQE MMRLDFHGGI GYFCHAILEI HRLDGSTEPQ YQTIDLKFLS IEDVKRFIED  240
YLAARAACGF GVVEDTKADF YQAMNPNFSN NQPPMLALPP VDDVPMRQAI VPDPALNVPS  300
VPLYVGLRDE PPVSKGKKRK QTPLAIQRER TGKLKLKDIS MHFHLPIQEA ARRMSLCPTV  360
VKKICRRGGL YRWPHRKIKS LLRKISSLKS SLETTKDAQA KARVEAEIER LEKQINEICS  420
EALKYA
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.233590.0flower
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009121515.10.0PREDICTED: uncharacterized protein LOC103846356
TrEMBLM4CWP90.0M4CWP9_BRARP; Uncharacterized protein
STRINGBra008646.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40762342
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.16e-08RWP-RK domain-containing protein